Protein Info for Pf1N1B4_839 in Pseudomonas fluorescens FW300-N1B4

Annotation: GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 10 to 205 (196 residues), 256.8 bits, E=9.2e-81
• PF00117: GATase
  • amino acids 11 to 200 (190 residues), 140.4 bits, E=1.4e-44
• PF07722: Peptidase_C26
  • amino acids 74 to 183 (110 residues), 27.1 bits, E=8.6e-10
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 213 to 525 (313 residues), 490.1 bits, E=2.7e-151
• PF02540: NAD_synthase
  • amino acids 215 to 292 (78 residues), 32.7 bits, E=1.1e-11
• PF03054: tRNA_Me_trans
  • amino acids 229 to 264 (36 residues), 21.5 bits, 4e-08
• PF00958: GMP_synt_C
  • amino acids 433 to 524 (92 residues), 140.3 bits, E=4.3e-45

Best Hits

Swiss-Prot: 98% identical to GUAA_PSEFS: GMP synthase [glutamine-hydrolyzing] (guaA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 98% identity to pfs:PFLU5043)

MetaCyc: 71% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (20/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See A0A166MVA6 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Pf1N1B4_839 GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Pseudomonas fluorescens FW300-N1B4)
MALDIHAHRILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGP
ESVHVADSPRCPQAVFDLGVPVFGICYGMQTMAEQLGGKVEGSDLREFGYARVDVVGKSR
LLDGIEDHIDADGLFGLDVWMSHGDKVTKMPEDFHILASTPSCPIAGMFNDARGYYGVQF
HPEVTHTKQGGRILSRFILDICGCEALWTPSKIAEDAIAQVRAQVGTDNVLLGLSGGVDS
SVVAALLHKAIGDQLTCVFVDNGLLRLHEGEQVMAMFAENMGVKVIRANAEDQFLDNLAG
ESDPEKKRKIIGRTFIDVFDAQSNKLDNIKYLAQGTIYPDVIESAGAKSGKAHVIKSHHN
VGGLPEEMNLKLVEPLRELFKDEVRRLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEY
ADLLRRADHIFIEELRKADWYHKVSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDF
MTARWAHLPYELLETVSGRIINEIEGISRVTYDVSSKPPATIEWE