Protein Info for Pf1N1B4_785 in Pseudomonas fluorescens FW300-N1B4

Annotation: acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF13420: Acetyltransf_4" amino acids 13 to 159 (147 residues), 33.1 bits, see alignment E=1.6e-11 PF00583: Acetyltransf_1" amino acids 21 to 139 (119 residues), 63.9 bits, see alignment E=5e-21 PF13302: Acetyltransf_3" amino acids 44 to 140 (97 residues), 29 bits, see alignment E=4.8e-10 PF13673: Acetyltransf_10" amino acids 52 to 143 (92 residues), 41.2 bits, see alignment E=4.7e-14 PF13508: Acetyltransf_7" amino acids 54 to 140 (87 residues), 42.7 bits, see alignment E=1.8e-14 PF08445: FR47" amino acids 81 to 140 (60 residues), 28.4 bits, see alignment E=4e-10

Best Hits

KEGG orthology group: None (inferred from 83% identity to pfo:Pfl01_4547)

Predicted SEED Role

"acetyltransferase, GNAT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162ARJ3 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Pf1N1B4_785 acetyltransferase, GNAT family (Pseudomonas fluorescens FW300-N1B4)
MWIQRLDASHALDYRALMLEAYDLHPQAFTSSVRERAVMPLSWWESRLTGKLDVVFGAFE
KGELAGIVGLAFESREKARHKATLFGMYVSGAVRQRGLGYQLVQAALAEAQTHQGLRLIQ
LTVTAGNEAAFKLYQRCGFVQFGLEPLAVRVGEDYFDKIHMWREITSEPLP