Protein Info for Pf1N1B4_772 in Pseudomonas fluorescens FW300-N1B4

Updated annotation (from data): ABC transporter for L-asparagine and L-glutamate, permease component 1
Rationale: Specifically important in carbon source L-Asparagine. Also important for glutamate utilization. We do not have fitness data for aspartate utilization - it may well transport aspartate as well. Also note that the aspariganase (Pf1N1B4_2023) is predicted to be cytoplasmic and is important for asparagine utilization, so we do not think that asparagine is converted to aspartate before uptake.
Original annotation: Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 25 to 131 (107 residues), 63.9 bits, see alignment E=7.9e-22 PF00528: BPD_transp_1" amino acids 44 to 238 (195 residues), 99.3 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 54% identical to GLTJ_ECOL6: Glutamate/aspartate import permease protein GltJ (gltJ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10003, glutamate/aspartate transport system permease protein (inferred from 94% identity to pfs:PFLU1138)

MetaCyc: 54% identical to glutamate/aspartate ABC transporter membrane subunit GltJ (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MU26 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Pf1N1B4_772 ABC transporter for L-asparagine and L-glutamate, permease component 1 (Pseudomonas fluorescens FW300-N1B4)
MNYNWDWGVFFKSTGVGSEIYFDWYLSGLGWTIAIAVAAWIIALLLGSILGVMRTVPNRI
VSGIATCYVELFRNVPLLVQLFIWYFLVPDLLPADIQEWYKQDLNPTTSAFLSVVVCLGL
FTTARVCEQVRTGIQALPRGQEAAARAMGFKLPQIYWNVLLPQAYRIIIPPLTSEFLNVF
KNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMSLMLLMRSVEKKVAVP
GLISVGGK