Protein Info for Pf1N1B4_76 in Pseudomonas fluorescens FW300-N1B4

Annotation: ATP binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF13514: AAA_27" amino acids 1 to 50 (50 residues), 24.7 bits, see alignment 5.8e-09 PF13476: AAA_23" amino acids 7 to 206 (200 residues), 49.8 bits, see alignment E=2.4e-16 PF02463: SMC_N" amino acids 28 to 366 (339 residues), 41.4 bits, see alignment E=4.1e-14 PF00005: ABC_tran" amino acids 28 to 63 (36 residues), 25.6 bits, see alignment 6.1e-09 PF13304: AAA_21" amino acids 166 to 360 (195 residues), 73.2 bits, see alignment E=1.4e-23 PF13175: AAA_15" amino acids 215 to 359 (145 residues), 40.9 bits, see alignment E=7.6e-14

Best Hits

KEGG orthology group: None (inferred from 81% identity to pfo:Pfl01_3725)

Predicted SEED Role

"ATP binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MET2 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Pf1N1B4_76 ATP binding protein (Pseudomonas fluorescens FW300-N1B4)
MEITSFKLKDVGRFTDLTVSLAPTAKHPSNVTVLVGNNGAGKTTLLKSLATSLSWLVARI
RTEKGNGNHLAEEDIRNGASSALILIGIEDESQARSSPPDASPEDALFTWGIARGRQGRK
AHIHSSLGGVSRLADHYRNQLTAFDKASLPLIAYYPVERSVLEIPLKIRTKHTFDQLDGY
DNSLNRGVDFRRFFEWFREREDSENETGVSDAALAEISDKFGKDSKVWKALSQVKASSRD
RQLTAVRSAIAAFMPGFSNLRVQRKPRLHMAIDKDGVTLNVSQLSQGEKSMMALVGDIAR
RLAMMNQSLDNPLEGDGIVLIDEVDLHLHPKWQRSLIRQLRETFPNCQFVLTTHSPLVIS
DAKDVLCYVLNDGELREHNGLYGLDANQVLLEVMDTDIRNSEVQQRLNRLMERLQDGDLD
EAKKLFSELSLELSDGHLELAKAALLIRKLELRRA