Protein Info for Pf1N1B4_663 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG00955324: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 204 to 229 (26 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details TIGR00374: TIGR00374 family protein" amino acids 7 to 316 (310 residues), 93.6 bits, see alignment E=7.8e-31 PF03706: LPG_synthase_TM" amino acids 8 to 309 (302 residues), 173.5 bits, see alignment E=3.9e-55

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 83% identity to pfo:Pfl01_4434)

Predicted SEED Role

"FIG00955324: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MRX7 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Pf1N1B4_663 FIG00955324: hypothetical protein (Pseudomonas fluorescens FW300-N1B4)
MSRGILLVVALLAAVLIPSLLGGGETWSRLQSFPLKWLLVMFGMILLCWMLNTLRLRLLL
GDQRGKISHVKSLGVVMSAEFAYCATPGGSGGPLTIMALLARHGVRPARGSAVFAMDQLS
DLLFFLCALSAILIYALFQHLSQRMEWLLTVSAISMFGGLFSCVLAARYHRSLIRLSGRL
LTRLNVQGTTRMRWARKLLHFLAAFTDTLKLPFQTLITVFALTCLHWLLRYSVLYLALRG
LGVDLQWAWCFLIQMLSLSAGQFSLLPGGAGAAELTSAALLAPMVGKSTAAAAILIWRTV
TYYFYLVVGGPVFLLMLGRPLLRKLMKFKRA