Protein Info for Pf1N1B4_661 in Pseudomonas fluorescens FW300-N1B4

Annotation: glycosyl transferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF13439: Glyco_transf_4" amino acids 18 to 179 (162 residues), 72 bits, see alignment E=1.2e-23 PF13579: Glyco_trans_4_4" amino acids 18 to 169 (152 residues), 55.9 bits, see alignment E=1.3e-18 PF00534: Glycos_transf_1" amino acids 191 to 339 (149 residues), 91 bits, see alignment E=1.3e-29 PF13692: Glyco_trans_1_4" amino acids 202 to 328 (127 residues), 86.2 bits, see alignment E=5.4e-28

Best Hits

KEGG orthology group: K14335, alpha-1,6-mannosyltransferase [EC: 2.4.1.-] (inferred from 86% identity to pba:PSEBR_a4462)

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MRW0 at UniProt or InterPro

Protein Sequence (373 amino acids)

>Pf1N1B4_661 glycosyl transferase, group 1 family protein (Pseudomonas fluorescens FW300-N1B4)
MFIVHIADITMFYAPASGGVRTYLDAKHRRLGSKSGIRHSLLIPGAHLSEQDGIYTVPAP
ALPFGKGYRFPLRLAPWRNVLQDLQPDLIEAGDPYLTAWAALDAKRQLDVPVIGFYHSDL
PLLVSNRMGNWVTPNVEAYVSKLYSNFDRVLAPSQIMADKLIGLGVKNVFVQPLGVDLQT
FNPNARDPGLRAELGIDENTHLLIFAGRGSKEKNLPVLLKCMKRLGRRYHLLLVGSSMPT
LVPRNVTVLNEFYPAAQVARLMASADALVHAGDQETFGLVVLEAMASGIPVVAVAAGAFR
EIVTDQCGLLCAPNNPAAMANAVRELFSQGSAALGKKARSHVEQHYAWDIVVDSLLGHYH
AVLGTQWPLIANG