Protein Info for Pf1N1B4_660 in Pseudomonas fluorescens FW300-N1B4

Annotation: Chemotactic transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 278 to 301 (24 residues), see Phobius details PF02743: dCache_1" amino acids 36 to 259 (224 residues), 100 bits, see alignment E=3.2e-32 PF22673: MCP-like_PDC_1" amino acids 71 to 180 (110 residues), 41 bits, see alignment E=4.6e-14 PF00672: HAMP" amino acids 296 to 348 (53 residues), 52.7 bits, see alignment 8.5e-18 PF00015: MCPsignal" amino acids 412 to 594 (183 residues), 146.4 bits, see alignment E=1.6e-46

Best Hits

Swiss-Prot: 74% identical to MCPG_PSEPK: Methyl-accepting chemotaxis protein McpG (mcpG) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 88% identity to pfl:PFL_4784)

Predicted SEED Role

"Chemotactic transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162BIF9 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Pf1N1B4_660 Chemotactic transducer (Pseudomonas fluorescens FW300-N1B4)
MNKNLRFSHKILLAAALIVIAAFASFTLYNDYLQRNAIRNDLDNYLQEMGSVTANNIQTW
LAGRSLLIENLSQNVALNADTDNVSKLLEQKAVTSTFMGAYLGNKDGTFIIRPDSKMPDG
YDPRVRPWYKSAQSTGGSALTEPYIDLASGQLVISIVNSVLKDGQSIGVVGGDLSLQVIA
DSLNALDFDGMGYAFLISADGKILVHPDKSLAMKSLSEAYPKNTPRIGSELSEIDVDGKT
RIVTFTPIKGLSSVNWYIGLSVDKDKAFSMLSEFRTSAVIATIIAVAIIIALLGMLIRLL
IQPLHVMTRAMEDIADGEGDLTKRLTIQNQDEFGILGTAFNRFVERVHTSIREVSSATGQ
VNEVALRVVAASNSSMFNSDQQASRTSSVAAAINQLGAAAQEIARNAAQASSQASDARSL
AEDGQQVVDRSIAAMNQLSTMLSASSTNIESLNSKTVNIGQILEVITSISQQTNLLALNA
AIEAARAGEAGRGFAVVADEVRNLAHRTQESAQQVQTMIEELQVGARESVSTMSDSQRHS
QDSVEIANLAGERLNSVTLRIGEIDGMNQSVATATEEQTAVVESINVDITEINTLNQEGV
ENLQSTLRACSDLEQQASRLKQLVGSFRI