Protein Info for Pf1N1B4_653 in Pseudomonas fluorescens FW300-N1B4

Annotation: ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF01923: Cob_adeno_trans" amino acids 8 to 173 (166 residues), 182.2 bits, see alignment E=4.6e-58 TIGR00636: ATP:cob(I)alamin adenosyltransferase" amino acids 9 to 186 (178 residues), 165.9 bits, see alignment E=3.5e-53

Best Hits

Swiss-Prot: 41% identical to PDUO_BACSU: Corrinoid adenosyltransferase (yvqK) from Bacillus subtilis (strain 168)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 92% identity to pfo:Pfl01_4424)

Predicted SEED Role

"ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161YZ11 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Pf1N1B4_653 ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17) (Pseudomonas fluorescens FW300-N1B4)
MGFRLSKIYTRTGDKGETGLGDGRRVPKDHPRIEAIGEVDTLNSQVGVLLAGLAAQSDTY
PGLNEVIEVLAPCQHRLFDLGGELAMPVYQALNTAEVERLEAAIDVWNEELGPLENFILP
GGSALIAQAHVCRCLARSAERRCQQLNAIEPLAGVGLAYINRLSDLLFVAARLIAKRQGV
AEILWQAAAKPEG