Protein Info for Pf1N1B4_632 in Pseudomonas fluorescens FW300-N1B4

Annotation: tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 8 to 418 (411 residues), 523.4 bits, see alignment E=2.1e-161 PF04052: TolB_N" amino acids 14 to 116 (103 residues), 95.4 bits, see alignment E=4.3e-31 PF07676: PD40" amino acids 184 to 217 (34 residues), 28.8 bits, see alignment 1.9e-10 amino acids 226 to 261 (36 residues), 51.9 bits, see alignment 1e-17 amino acids 270 to 305 (36 residues), 53.5 bits, see alignment 3.2e-18 amino acids 362 to 389 (28 residues), 13.1 bits, see alignment (E = 1.6e-05)

Best Hits

Swiss-Prot: 94% identical to TOLB_PSEPF: Tol-Pal system protein TolB (tolB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03641, TolB protein (inferred from 94% identity to pba:PSEBR_a4435)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MRF7 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Pf1N1B4_632 tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins (Pseudomonas fluorescens FW300-N1B4)
MFCFAGLATADEKNILVSSGSSQATPIAVVPFGFQGGTVLPDDMAEIIGNDLRNSGYYAP
IPKQNMISQPSQASEIIFRDWKAVGAQYIMVGSIVPAGGRLQVQYALFNVATEQQVLTGS
VSGSVDQLRDMAHYISDQSFEKLTGIKGAFSTRLLYVTAERFSEKNTRYTLQRSDYDGAR
AVTLLQSREPILSPRFAPDGKRIAYVSFEQKRPRIFMQNIDTGRREQITNFEGLNGAPAW
SPDGQRLAFVLSKDGNPDIYVMNLGSRQISRVTNGQGINTEPFWGKDGSTIYFTSDRGGK
PQIYKTSAGGGGAERVTFIGNYNANPKLSADEKTLVMIHRQEGFTNFKVAAQDLQRGSVK
ILTDSTLDESPTVAPNGTMVIYATRQQGRGVLMLVSINGRVRLPLPTAQGEVREPSWSPY
LN