Protein Info for Pf1N1B4_631 in Pseudomonas fluorescens FW300-N1B4

Annotation: 18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02802: peptidoglycan-associated lipoprotein" amino acids 64 to 163 (100 residues), 139.5 bits, see alignment E=1.9e-45 PF00691: OmpA" amino acids 65 to 159 (95 residues), 86.6 bits, see alignment E=6.3e-29

Best Hits

Swiss-Prot: 99% identical to PAL_PSEPK: Peptidoglycan-associated lipoprotein (pal) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 96% identity to pmk:MDS_1312)

Predicted SEED Role

"18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C1WMV2 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Pf1N1B4_631 18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor (Pseudomonas fluorescens FW300-N1B4)
MEMLKFGKFAALALAMAVAVGCSSKGGDNAGEGAVDPNAGYGANTGAVDGSLSEEAALRA
ITTFYFEYDSSDLKPEAMRALDVHAKDLKANGARVVLEGNTDERGTREYNMALGERRAKA
VQRYLVLQGVSPAQLELVSYGEERPVATGNDEQSWAQNRRVELRK