Protein Info for Pf1N1B4_603 in Pseudomonas fluorescens FW300-N1B4

Annotation: Methylglyoxal synthase (EC 4.2.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 59% identical to MGSA_CELJU: Methylglyoxal synthase (mgsA) from Cellvibrio japonicus (strain Ueda107)

KEGG orthology group: K01734, methylglyoxal synthase [EC: 4.2.3.3] (inferred from 88% identity to pfl:PFL_4624)

MetaCyc: 55% identical to methylglyoxal synthase (Escherichia coli K-12 substr. MG1655)
Methylglyoxal synthase. [EC: 4.2.3.3]

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162BIA3 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Pf1N1B4_603 Methylglyoxal synthase (EC 4.2.3.3) (Pseudomonas fluorescens FW300-N1B4)
MIGISFTQKTLAARKRIALVAHDHCKVFLLDWAERQKDKLAQHELVATGTTGLLLQQRLD
LPVESMISGPLGGDQQLGARIAEQRVDMLVFFWDPFEPQPHDPDIKALLRVAAVWNIPVA
CNECSADYLLSSPLMDQAHEHRIPDYATYLLGRG