Protein Info for Pf1N1B4_6029 in Pseudomonas fluorescens FW300-N1B4

Updated annotation (from data): uridine nucleosidase (EC 3.2.2.3)
Rationale: Important on uridine; annotated by SEED as for uridine and inosine; close homologs are important for utilizing uridine (SEED_correct)
Original annotation: Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01156: IU_nuc_hydro
  • amino acids 34 to 332 (299 residues), 310.8 bits, E=6.4e-97

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a3705)

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• pyrimidine ribonucleosides salvage III (2/2 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• pyrimidine ribonucleosides salvage II (1/2 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.1 or 3.2.2.3

Sequence Analysis Tools

See A0A166R3Y5 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Pf1N1B4_6029 uridine nucleosidase (EC 3.2.2.3) (Pseudomonas fluorescens FW300-N1B4)
MQRYAQKLHHLLRSLLLLSLITATSAQAAEKIDLIIDTDPGADDVVALLFALASPDELNI
RALTTVAGNVRLDKTSRNARLAREWAGREEVPVYAGAPKPMMRTPIYAENIHGKEGLSGV
TVHEPKKGLAEGNAVNYLIDTLKTAKPHSITIAMLGPQTNLALALIQEPEIVQGIKEVVI
MGGAHFNGGNITPVAEFNLFADPQAAEVVLKSGVKLTYLPLDVTHKILTSEARLKQIAAL
NNNASKLVGDILNEYVKGDMEHYGIPGGPVHDATVIAYLLKPELFTGRSVNVVVDSREGP
TFGQTIVDWYDGLKAPKNAFWVESGDAQGFFDLLTQRLSRLK