Protein Info for Pf1N1B4_6025 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cold shock protein CspG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 70 PF00313: CSD" amino acids 6 to 68 (63 residues), 102.5 bits, see alignment E=4.4e-34

Best Hits

Swiss-Prot: 97% identical to CAPA_PSEFR: Cold shock protein CapA (Fragment) (capA) from Pseudomonas fragi

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 97% identity to pst:PSPTO_2376)

Predicted SEED Role

"Cold shock protein CspG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C1ZMH0 at UniProt or InterPro

Protein Sequence (70 amino acids)

>Pf1N1B4_6025 Cold shock protein CspG (Pseudomonas fluorescens FW300-N1B4)
MSNRQTGTVKWFNDEKGFGFITPQGGGDDLFVHFKAIESDGFKSLKEGQTVSFVAEKGQK
GMQAAQVRPE