Protein Info for Pf1N1B4_5984 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG005548: transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 838 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details amino acids 390 to 415 (26 residues), see Phobius details amino acids 451 to 472 (22 residues), see Phobius details amino acids 657 to 673 (17 residues), see Phobius details amino acids 680 to 703 (24 residues), see Phobius details amino acids 708 to 729 (22 residues), see Phobius details amino acids 750 to 774 (25 residues), see Phobius details amino acids 781 to 807 (27 residues), see Phobius details PF03176: MMPL" amino acids 628 to 808 (181 residues), 40.8 bits, see alignment E=6.9e-15

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 70% identity to psa:PST_0618)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166R2Z2 at UniProt or InterPro

Protein Sequence (838 amino acids)

>Pf1N1B4_5984 FIG005548: transport protein (Pseudomonas fluorescens FW300-N1B4)
MGHTKQETMPVIRDLRDFDRHSGNRLERLVFNYRPLFMLLMALATVVLGYMAATRLELRP
SFEKMIPQSQPYIQNFLENRQSLRGLGNSVRVVVENTQGDIFDPAYLDVLNQVNDQLFVT
EGVDRAWMKSLWSPAVRWTEVTEEGFQGGPVMPDTYQGKSEEIEQLRQNISRAGIVGSLV
ASDYKSSMLIVPLLDKATASGQRIDYHAFSQMLEEQLRDKIEFAGDSAARKAGEEGKGQY
KVRVIGFAKLMGDLIDGLIQVMMFFGLAVVTSLIIIYAYTRCVRSTLLVVGCSLIAVVWQ
LGIVAWLGYAIDPYSVLVPFLIFAIGVSHAAQKMNGIMQDIARGTHKLIAARYTFRRLFI
AGVTALLADAVGFAVLMLIDIPVIRDLAITASIGVAVLIFTSLLLMPVALSYIGVGAMAA
ERALKIDTRAEGHKGFGKLWDLLDRFTTAKWATGAVLVAALMGIGGFMVSLQLKIGDLES
GAPELRADSRYNRDNAYITSHYALSSDLFAVMIKTAPEGCLNYKTLVLADRLAWELQQYP
GVQATASLVNAVRQITAGTYEGNPKLNSIQRNQDVLNYAAQQASVNSPELFNTDCSLMPV
ITFLKDHKAETLDAVVGIAEKFARENNSEDRQFLLAAGSAGIEAATNIVVREANRTMLLY
VYAAVTLFCLITFRSWRATLVALLPLVLTSILCEALMVAMGIGVKVATLPVIALGVGIGV
DYALYLLSVQLHYQRQGLPLSQAYRNAVSFTGRVVGLVGITLAAGVVCWVWSPIKFQADM
GILLTFMFLWNMLGALILIPALSYFLLRHPVAQAKVAQATETDTSQRQGMPHALTTSE