Protein Info for Pf1N1B4_5939 in Pseudomonas fluorescens FW300-N1B4

Annotation: dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 4 to 340 (337 residues), 518.7 bits, see alignment E=2.7e-160 PF04321: RmlD_sub_bind" amino acids 4 to 177 (174 residues), 49.2 bits, see alignment E=1.2e-16 PF02719: Polysacc_synt_2" amino acids 5 to 115 (111 residues), 47.5 bits, see alignment E=4.5e-16 PF01370: Epimerase" amino acids 5 to 253 (249 residues), 243.9 bits, see alignment E=5e-76 PF01073: 3Beta_HSD" amino acids 6 to 234 (229 residues), 44.5 bits, see alignment E=3.2e-15 PF16363: GDP_Man_Dehyd" amino acids 6 to 324 (319 residues), 310.5 bits, see alignment E=5.2e-96 PF07993: NAD_binding_4" amino acids 77 to 190 (114 residues), 32.5 bits, see alignment E=1.6e-11

Best Hits

Swiss-Prot: 74% identical to RMLB_NEIMB: dTDP-glucose 4,6-dehydratase (rfbB1) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 76% identity to yep:YE105_C0176)

MetaCyc: 70% identical to dTDP-glucose 4,6-dehydratase 2 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XH30 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Pf1N1B4_5939 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) (Pseudomonas fluorescens FW300-N1B4)
VTQRIIVTGGAGFIGSAVVRHLIDNTDVSVLNIDKLTYAGNTESLASVAGSPRYEFQQVD
ICDTAALHELFARFQPDAVMHLAAESHVDRSIDSPSDFIQTNIVGTYSMLEASRRYWSGL
AAEQKQGFRFHHISTDEVYGDLEGTDDLFTETTPYEPSSPYSASKAGSDHLVRAWHRTYG
LPVLVTNCSNNYGPFHFPEKLIPHVILNAIHGEPLPVYGDGSQIRDWLFVEDHARALFEV
VSRGTVGETYNIGGHNEKRNLQVVETICELLDELRPRDEELGSYKELITFVTDRPGHDRR
YAIDASKIERELGWRPQETFESGLLKTVQWYLDNQEWWQRVLNGEYRPERLGHIG