Protein Info for Pf1N1B4_5927 in Pseudomonas fluorescens FW300-N1B4

Annotation: Capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 35 to 461 (427 residues), 441 bits, see alignment E=6.4e-136 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 41 to 461 (421 residues), 453.1 bits, see alignment E=1.5e-139 PF13727: CoA_binding_3" amino acids 74 to 238 (165 residues), 67.5 bits, see alignment E=1.5e-22 PF02397: Bac_transf" amino acids 276 to 459 (184 residues), 222.1 bits, see alignment E=4e-70

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 67% identity to pfo:Pfl01_3829)

Predicted SEED Role

"Capsular polysaccharide biosynthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166R1L9 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Pf1N1B4_5927 Capsular polysaccharide biosynthesis protein (Pseudomonas fluorescens FW300-N1B4)
MVHNRINRNNITKGLTFWGQWIIAITSVNTLLFGLALYQTGEIDAHYRVLAVLTFLGSVP
SYSLLLVYHKQHSYLSGLARLLLGWLLLLAGLTSIGFFSKTSELFSREIIVVWATAGYCI
QALLYLPLHSFSKHYQRQLHSQYNTLIIGTDQLAVNLADKLTKTEYPPLVGLISSNPNEL
STQVNAHRVLGPLQELRELIQVHDVRRLYIALPLSEAKQVEALYIDLLDANVDVVWVPDL
GSMTLLNHSISELDGLPAIHLNESPLTSYPTAALSKTLLDRSLAALALIGFSPLLLVIAA
AVKISSPGPIIFKQERHGWNGKIIKVWKFRSMRLHDDHQVRQAGREDPRITAVGRFIRRT
SIDELPQFFNVLQGHMALVGPRPHAVAHNDYYTGKIQAYMARHRIKPGITGLAQISGCRG
ETETLDKMQKRVEIDLNYINNWSLWLDIKILIKTPFTLFSKDIY