Protein Info for Pf1N1B4_5833 in Pseudomonas fluorescens FW300-N1B4

Annotation: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02429: 3-oxoacid CoA-transferase, A subunit
  • amino acids 5 to 217 (213 residues), 243.2 bits, E=9.9e-77
• PF01144: CoA_trans
  • amino acids 11 to 217 (207 residues), 255.1 bits, E=2.3e-80

Best Hits

Swiss-Prot: 64% identical to SCOA_BACSU: Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A (scoA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01028, 3-oxoacid CoA-transferase subunit A [EC: 2.8.3.5] (inferred from 92% identity to pfs:PFLU2152)

MetaCyc: 61% identical to succinyl-CoA-transferase subunit A (Helicobacter pylori 26695)
3-oxoacid CoA-transferase. [EC: 2.8.3.5]

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

• ketolysis (3/3 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5

Use Curated BLAST to search for 2.8.3.5

Sequence Analysis Tools

See A0A166QZK3 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Pf1N1B4_5833 Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5) (Pseudomonas fluorescens FW300-N1B4)
MAGFDKRVYSYEEAMAGLEDGMTVISGGFGLCGIPENLIAEIQHRGTRDLTVVSNNCGVD
GFGLGVLLVDRQIRKVVASYVGENALFEKQLLSGEIEVVLTPQGTLAEKMRAGGAGIPAF
FTATGVGTPVADGKEVREFKGRQYLMEESITGDFAIVKGWKADHFGNVVYRHTAQNFNPL
AATAGKITVVEVEEIVEPGELDPSQIHTPGIYVDRVICGTFEKRIEQRTVRK