Protein Info for Pf1N1B4_5827 in Pseudomonas fluorescens FW300-N1B4

Annotation: Na(+) H(+) antiporter subunit G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 11 to 97 (87 residues), 69.3 bits, see alignment E=1.4e-23 PF03334: PhaG_MnhG_YufB" amino acids 12 to 92 (81 residues), 72.4 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: K05564, multicomponent K+:H+ antiporter subunit G (inferred from 92% identity to pfo:Pfl01_3315)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XGU2 at UniProt or InterPro

Protein Sequence (116 amino acids)

>Pf1N1B4_5827 Na(+) H(+) antiporter subunit G (Pseudomonas fluorescens FW300-N1B4)
LSLWVEIAVAILLVLSSLFTLIGAAGLLRMKDYFQRMHPPALASTLGAWCVALASIIYFS
ALKSAPVLHAWLIPVLLSITVPVTTLLLARAALFRKRMAGDDVPAEVSSRRTESGS