Protein Info for Pf1N1B4_578 in Pseudomonas fluorescens FW300-N1B4

Annotation: enoyl-CoA hydratase, R-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01575: MaoC_dehydratas
  • amino acids 17 to 115 (99 residues), 93.9 bits, E=5.6e-31
• PF13452: MaoC_dehydrat_N
  • amino acids 17 to 131 (115 residues), 39.9 bits, E=4.6e-14

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfl:PFL_4601)

MetaCyc: 87% identical to (R)-specific enoyl-CoA hydratase (Pseudomonas oleovorans)
RXN-7699 [EC: 4.2.1.119]

Predicted SEED Role

"enoyl-CoA hydratase, R-specific" in subsystem n-Phenylalkanoic acid degradation

MetaCyc Pathways

• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• polyhydroxydecanoate biosynthesis (2/3 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• 6-gingerol analog biosynthesis (engineered) (3/6 steps found)
• fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
• 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
• 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
• 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (9/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.119

Sequence Analysis Tools

See A0A166MQA1 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Pf1N1B4_578 enoyl-CoA hydratase, R-specific (Pseudomonas fluorescens FW300-N1B4)
MTQVTNTPYEALEVGQTASYSKTVEERDIQLFAAMSGDHNPVHLDAEFAAASMFKERIAH
GMFSGALISAAVACELPGPGTIYIGQTMSFQKPVKIGDTLTVRLEILEKLPKFRVRIATR
VFNQRDELVVDGEAEILAPRKQQTVTLPTLPAISIG