Protein Info for Pf1N1B4_5779 in Pseudomonas fluorescens FW300-N1B4

Annotation: Nitrous oxide reductase maturation protein NosF (ATPase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00005: ABC_tran" amino acids 19 to 156 (138 residues), 101.3 bits, see alignment E=7.4e-33 PF13304: AAA_21" amino acids 129 to 186 (58 residues), 27.5 bits, see alignment E=3e-10

Best Hits

Swiss-Prot: 76% identical to NOSF_PSEST: Probable ABC transporter ATP-binding protein NosF (nosF) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 78% identity to pba:PSEBR_a2646)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosF (ATPase)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QY85 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Pf1N1B4_5779 Nitrous oxide reductase maturation protein NosF (ATPase) (Pseudomonas fluorescens FW300-N1B4)
MNVIDMEGVSQRYGYTTVLHQLNLSLGEGEVLGLFGHNGAGKTTSMKLVLGLLQASEGQV
RVFGRLPSDPQVRRLLGYLPENVTFYPQMSGLETLRHFARLKGAALAQVDVLLEEVGLAG
AAHRRVKTYSKGMRQRLGLAQALLGEPRLLLLDEPTVGLDPIATQDLYRLLDRLRSQGTS
IILCSHVLPGVEAHINRAAILTQGRLLALGSLRSLREEAGLPTLIRANGLKHVGPLQRSW
NNAGHVTQRWGVEGLEVAALNGNKLDLLRQLLNEHEPADVEIDPPSLEDIYRYYMGRAGA
TPSGETV