Protein Info for Pf1N1B4_5763 in Pseudomonas fluorescens FW300-N1B4

Annotation: Nitric oxide reductase activation protein NorQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00158: Sigma54_activat" amino acids 21 to 109 (89 residues), 21 bits, see alignment E=4.7e-08 PF07728: AAA_5" amino acids 30 to 164 (135 residues), 126.9 bits, see alignment E=1.2e-40 PF08406: CbbQ_C" amino acids 177 to 260 (84 residues), 99 bits, see alignment E=2.9e-32

Best Hits

Swiss-Prot: 91% identical to NIRQ_PSEST: Denitrification regulatory protein NirQ (nirQ) from Pseudomonas stutzeri

KEGG orthology group: K04748, nitric oxide reductase NorQ protein (inferred from 93% identity to pba:PSEBR_a3171)

Predicted SEED Role

"Nitric oxide reductase activation protein NorQ" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QXX3 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Pf1N1B4_5763 Nitric oxide reductase activation protein NorQ (Pseudomonas fluorescens FW300-N1B4)
MDRIQSCEPFYQPLNNEEALFEQAWRHGMPVLIKGPTGCGKTRFVQHMAHRLKLPLYTVA
CHDDLSAADLIGRHLIGAQGTWWQDGPLTRAVREGGICYLDEVVEARQDTVVVLHPLADD
RRELFLERTGEVLQAPPSFMLVVSYNPGYQNLLKGMKPSTRQRFVAMRFGYPPVADEERI
VTREAQVDSALAAQVVRLGQALRRLDQHDLEEVASTRLLIFTARMIRSGMSPREACMACL
AEPLSDDPLTVAALMDVVDVHFG