Protein Info for Pf1N1B4_5755 in Pseudomonas fluorescens FW300-N1B4

Annotation: NnrS protein involved in response to NO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details PF05940: NnrS" amino acids 14 to 172 (159 residues), 161.9 bits, see alignment E=1.6e-51

Best Hits

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>Pf1N1B4_5755 NnrS protein involved in response to NO (Pseudomonas fluorescens FW300-N1B4)
MQVLDRRKAMAIAPLLRLAFRPFFLAGCLLAVLAIPLWLAAFSGSMSDWQPAGGWLGWHR
HELLFGFGLAIIAGFLLTAVQTWTGRPGLSGKPLGALALLWLLARVAWLANVPWPLLAVL
EMAFPLALVVLMGFTLWKVRQKRNYPIVVVLLLLAVADGLSLYGLVEGMKAGSARVC