Protein Info for Pf1N1B4_5686 in Pseudomonas fluorescens FW300-N1B4

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details PF00892: EamA" amino acids 13 to 120 (108 residues), 35.9 bits, see alignment E=4.1e-13

Best Hits

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>Pf1N1B4_5686 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens FW300-N1B4)
MMDKTLRRGSFEMTAAMLISGTIGWFVLVSGQPVLDVVFWRCVFGAATLLLICAAFGFLR
PGILTSTTFLLAVLSGVAIVGNWVLLFASYSRASIAIGTAVYNVQPFMLVGLAALFLGRR
SPSRSCSGWAFRF