Protein Info for Pf1N1B4_5685 in Pseudomonas fluorescens FW300-N1B4

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details PF00892: EamA" amino acids 20 to 147 (128 residues), 69.5 bits, see alignment E=1.7e-23

Best Hits

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>Pf1N1B4_5685 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens FW300-N1B4)
MLAIVSAHGEQGEGGNDYLMGIGLALGAAFLYAIAALIIKRLTGTPPHLIALIQVCTGVL
LLAPFAHFSAIPQTPDAWASLVTLGIVHTGLMYVLLYGAIQKLPTALTGALSFIYPIAAI
FVDWFAFGHRLEPLQWIGVAAILLAAAGMQQGWSLKLRRVAAQ