Protein Info for Pf1N1B4_5678 in Pseudomonas fluorescens FW300-N1B4

Annotation: sensory box histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details PF00989: PAS" amino acids 174 to 277 (104 residues), 27.2 bits, see alignment E=1.2e-09 TIGR00229: PAS domain S-box protein" amino acids 179 to 287 (109 residues), 34 bits, see alignment E=1.4e-12 PF13426: PAS_9" amino acids 184 to 279 (96 residues), 20.8 bits, see alignment E=1.3e-07 PF08447: PAS_3" amino acids 185 to 273 (89 residues), 56 bits, see alignment E=1.4e-18 PF00512: HisKA" amino acids 324 to 384 (61 residues), 27.6 bits, see alignment 8.8e-10 PF02518: HATPase_c" amino acids 428 to 547 (120 residues), 69.8 bits, see alignment E=9.6e-23 PF00072: Response_reg" amino acids 570 to 682 (113 residues), 47.6 bits, see alignment E=6e-16

Best Hits

KEGG orthology group: None (inferred from 77% identity to pba:PSEBR_a1933)

Predicted SEED Role

"sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XNA5 at UniProt or InterPro

Protein Sequence (687 amino acids)

>Pf1N1B4_5678 sensory box histidine kinase/response regulator (Pseudomonas fluorescens FW300-N1B4)
MAGRIRAFDWSLTELGSIDTWPGSLCSAVQLLLASPLPMVMLWGRPGYMIYNDAYSRFAG
GRHPYLLGSPVELGWPEVAEFNRHVVDTCLAGGTLSYHNKALVLLRDGVPEDVWMDLYYS
PVADDDGHPAGVMAMVVDTTDHVISERRRQEAESAYRADNERVRLALNAGALLGSFVWDI
KANVLSADERFARTFSYPPDQDLANLPPLIAEMQIHPDDRSWVQERLNQSVESGIPYNAE
YRVLRPDGSYLWVLASGCCEFDEKGEAFRFPGVLIDIHERKTAEESLLKFTRNLEQRVAD
EVEARLAAEEQLRQSQKLEAIGGLTGGVAHDFNNLLQVIAGNLHLLARHEPDNANVQRRV
SASIAAVERGAKLSSQLLAFARRQPLSPAVCDPRQIFEGLGELLQRALGETIQIKVTAPD
DPWHLYVDRNQLENAILNLAINARDAMNGEGTIALSAENITLDRKFCAGKGIVAGDYVCV
AVADTGVGMSPQVLAQAFEPFFTTKADGQGTGLGLSMVFGFVKQSDGHIEISSVVGQGTR
VQLYFPRSLRPLPGETTRHDPQHRGGHETILVVEDNEAVRGSAVDLLREEGYQVLTAANG
DLAMQMLLDGVAVDLIFTDVVMPGLIKSADLAAWAKVQNPPVAVLFTSGHTRDIISRNHQ
LSPDTYLLSKPYGPEALLSMIRSVLGG