Protein Info for Pf1N1B4_5659 in Pseudomonas fluorescens FW300-N1B4

Annotation: NfuA Fe-S protein maturation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 TIGR03341: IscR-regulated protein YhgI" amino acids 4 to 194 (191 residues), 304 bits, see alignment E=2e-95 PF01521: Fe-S_biosyn" amino acids 4 to 100 (97 residues), 36.7 bits, see alignment E=4.4e-13 PF01106: NifU" amino acids 114 to 180 (67 residues), 70.5 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 98% identical to NFUA_PSEPF: Fe/S biogenesis protein NfuA (nfuA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07400, Fe/S biogenesis protein NfuA (inferred from 97% identity to pfl:PFL_3660)

MetaCyc: 53% identical to iron-sulfur cluster carrier protein NfuA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NfuA Fe-S protein maturation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZGD4 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Pf1N1B4_5659 NfuA Fe-S protein maturation (Pseudomonas fluorescens FW300-N1B4)
MTAITITDAAHDYLADLLSKQNTPGIGIRVFITQPGTQYAETCIAYCKPGEEKPEDTALG
LKSFTAYIDHFSEAFLDDAVVDYATDRMGGQLTIKAPNAKVPMVNADSPVNERINYYLQT
EINPGLASHGGQVSLIDVVEDGIAVLKFGGGCQGCGQADVTLKEGIERTLLERIPELKGV
RDVTDHTQKENAYY