Protein Info for Pf1N1B4_5656 in Pseudomonas fluorescens FW300-N1B4

Annotation: Predicted cobalt transporter CbtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 78 to 98 (21 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details TIGR02458: cobalt transporter subunit CbtA (proposed)" amino acids 1 to 227 (227 residues), 293.3 bits, see alignment E=6.4e-92 PF09490: CbtA" amino acids 3 to 225 (223 residues), 187.1 bits, see alignment E=2.5e-59

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfo:Pfl01_3101)

Predicted SEED Role

"Predicted cobalt transporter CbtA" in subsystem Coenzyme B12 biosynthesis or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XN85 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Pf1N1B4_5656 Predicted cobalt transporter CbtA (Pseudomonas fluorescens FW300-N1B4)
MIKRIAQTAGFTGLLAALLLTLLQSFWVAPLILQAETYEKSEPAAVEIHEHAAGAVTAHT
HDAEAWSPEDGWQRVLSTTGGNLVVAVGFALMLAGLYTLRAPRRTSQGLLWGLAGYATFV
LAPTLGLPPELPGTAAADLAQRQIWWIGTAASTAVGIALIVFSRHWLMKILGVAILAAPH
VIGAPQPEVHSMLAPEALEAQFKIASQLTNMAFWLALGLISAWLFRRKSDGQYSA