Protein Info for Pf1N1B4_5644 in Pseudomonas fluorescens FW300-N1B4

Annotation: amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 111 (97 residues), 97.3 bits, see alignment E=3.2e-32 PF00528: BPD_transp_1" amino acids 35 to 216 (182 residues), 80.8 bits, see alignment E=5.5e-27

Best Hits

Swiss-Prot: 38% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 97% identity to pfo:Pfl01_3091)

MetaCyc: 38% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XGF4 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Pf1N1B4_5644 amino acid ABC transporter, permease protein (Pseudomonas fluorescens FW300-N1B4)
MNYQLNFAAVWRDFDTLLAGLGLGLELALVSIAIGCVIGLLMAFALLSKHRPLRVLASVY
VTVIRNTPILVLILLIYFALPSLGVRLDKIPSFIITLSLYAGAYLTEVFRGGLLSIPKGL
REAGLAIGLGEWQVKAYITVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKI
NVESYRVIETWLVTTALYVAACYLIAMMLRYLEQRLAIRR