Protein Info for Pf1N1B4_5643 in Pseudomonas fluorescens FW300-N1B4

Annotation: Amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 17 to 112 (96 residues), 78.6 bits, see alignment E=2.1e-26 PF00528: BPD_transp_1" amino acids 36 to 217 (182 residues), 79.5 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 92% identity to pba:PSEBR_a1960)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QVJ2 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Pf1N1B4_5643 Amino acid ABC transporter, permease protein (Pseudomonas fluorescens FW300-N1B4)
MYESPSWLHELWVAREVLWQGFLTSVQCSALAILLGTLVGIVAGLVLTYGTFWMRAPFRF
YVDIIRGTPVFVLVLACFYMAPALGWQISAFGAGTLGLTLFCGSHVAEIVRGALQALPSG
QMEASKAIGLTFYQALGYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQ
IIARTFMTLEFYLFAGLLFFIINYAIELLGRHIEKRVALP