Protein Info for Pf1N1B4_5626 in Pseudomonas fluorescens FW300-N1B4

Annotation: ABC transporter, periplasmic substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00496: SBP_bac_5" amino acids 104 to 513 (410 residues), 229.1 bits, see alignment E=4.6e-72

Best Hits

KEGG orthology group: K13893, microcin C transport system substrate-binding protein (inferred from 90% identity to pfo:Pfl01_3073)

Predicted SEED Role

"ABC transporter, periplasmic substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZGA5 at UniProt or InterPro

Protein Sequence (622 amino acids)

>Pf1N1B4_5626 ABC transporter, periplasmic substrate-binding protein (Pseudomonas fluorescens FW300-N1B4)
MRLAFPTLLFTAVALLLSAAGVNAAPQHALTVYGEPAKYPAGFSHFAYTNPRAPKGGTMR
RSAMEIGHFDHMLPYIDKGTGVTQIDGLIYSPLAQRSLDEPYTVYGLVAQRMERSDDGLS
LHFYLNPKARFADGKPITAEDVRYTFNLLMTQGSLRYRTQFADVKGVEVESPLTVRFDFK
SNENRTLPLDLATLPVFPEHWWKTRDFASGGGYEPPLGSGPYRVSKVDSGRSITFERNAD
WWAKDLPVSRGLYNFDHFSIEYFGDTDVARQVLRGGAYDYNREFSATAYSIGYESPALSD
GRLQKAHLAKEAPQSAQGFVFNLQNPMFQDRRVRQALAMLWDFEWSNRQMMREMYIRQQS
YFSNTDLAARELPDAGERAILEPLRGQIPDEVFTQVFEAPKTDGSGVIRDKQLQALGLLE
QAGWKPDGDQLVNAQGQSLSFTFLVSQNGMDRLLLPYKRTLKQIGIDLNIRRIDASQYIN
RLMSRDYDMIVTGYPVTTSPGNELYNYFGSAAANDPGSNNYMVLKNPAVDTLVNGLVRAT
TQADMLRYAHALDRVLQWNFYWIPNYYPPGSSTVWWNRFGIPSVQASNDEAIESWWEVST
TPLTNEQMTAELIKRGQPGGPR