Protein Info for Pf1N1B4_5625 in Pseudomonas fluorescens FW300-N1B4

Annotation: Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13616: Rotamase_3
  • amino acids 11 to 91 (81 residues), 83.1 bits, E=3.3e-27
• PF13145: Rotamase_2
  • amino acids 12 to 92 (81 residues), 31.9 bits, E=3.1e-11
• PF00639: Rotamase
  • amino acids 13 to 89 (77 residues), 76.1 bits, E=5.4e-25

Best Hits

Swiss-Prot: 54% identical to PPIC_ECOLI: Peptidyl-prolyl cis-trans isomerase C (ppiC) from Escherichia coli (strain K12)

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 90% identity to psa:PST_1598)

MetaCyc: 54% identical to peptidyl-prolyl cis-trans isomerase C (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

See A0A166QV98 at UniProt or InterPro

Protein Sequence (93 amino acids)

>Pf1N1B4_5625 Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) (Pseudomonas fluorescens FW300-N1B4)
MAKATARHILVSSEEKCNELKAQIEAGADFAEVAKANSSCPSSRQGGDLGSFGPGQMVKE
FDTVVFSAPINVVQGPVKTQFGYHLLEVTSRQD