Protein Info for Pf1N1B4_562 in Pseudomonas fluorescens FW300-N1B4

Annotation: Histidine transporter, periplasmic histidine-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04069: OpuAC" amino acids 30 to 315 (286 residues), 197.7 bits, see alignment E=1.4e-62

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 93% identity to pfo:Pfl01_4344)

Predicted SEED Role

"Histidine transporter, periplasmic histidine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MQ29 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Pf1N1B4_562 Histidine transporter, periplasmic histidine-binding protein (Pseudomonas fluorescens FW300-N1B4)
MRSIKTLLGSSLLALSLVAGHVPAAEKTTPIHFGDITWESGSLITEILRLIVEKGYGYPT
DTLPGSTVSLEAALAKNDIQVIGEEWAGRSPAWVKAASEGKVFGLGDTVKGATEGWWVPE
YVIKGDPERGIKPLAPELKSVADLARYKDVFRDPEDPSRGRFLNSPTGWTSEIVNSQKLK
AYDLTASYVNFRTGSGAALDAEVASSIRRGKPVLFYYWSPTPLLGRFKLVKLEEPPFDAQ
AWKTLADANNPNPKGTRSMPASLAIGVSAPFKAQYPDLVAFFEKVDLPIDLLNQTLGQMS
EKRQPPRQVAEAFLRDQPQVWKAWVPGEVATKVSESL