Protein Info for Pf1N1B4_5604 in Pseudomonas fluorescens FW300-N1B4

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 10 to 35 (26 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 277 to 308 (32 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 342 to 359 (18 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 312 (295 residues), 70.6 bits, see alignment E=5.9e-24

Best Hits

KEGG orthology group: None (inferred from 92% identity to psb:Psyr_2181)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166R4J5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Pf1N1B4_5604 Permeases of the major facilitator superfamily (Pseudomonas fluorescens FW300-N1B4)
LNHQTRLPSVFGIFVLGMLQVLVWGGSFFLMAVMADPIMRETGWASQWVYGALSLSILVS
AMLAPLTSRLIARYGGRPILASSGLGVAIGLFLMASSTSLPMFLLSWAVIGVGMALGLYE
ALFAALGSLYGERAGSAITGITLISGFATTLSWPAVALVIEHIGWRATCVAYGGLLVIAV
APLYLWVLAPGAGQLAKSHAMSDENLSVDRRIYLLLTLIFALGAVIMTAISVQLISLLQG
QGYSLAAAIGLSALLGPSQVGSRVLQVFSRKRHPIWTTLISVVFVAIGLLLVTIAPAMTA
LGLVIYGAGNGLRAIVRGLLPLALMSSTHYVLLMGRMARPSLIGQALTPLAGGYLLQTWG
ASGVLAGLSSLAVLNVLLVFLLIRLV