Protein Info for Pf1N1B4_5589 in Pseudomonas fluorescens FW300-N1B4

Annotation: 3-ketoacyl-CoA thiolase (EC 2.3.1.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00108: Thiolase_N
  • amino acids 13 to 280 (268 residues), 161.9 bits, E=2e-51
• TIGR01930: acetyl-CoA C-acyltransferase
  • amino acids 15 to 407 (393 residues), 324.4 bits, E=4.9e-101
• PF02803: Thiolase_C
  • amino acids 288 to 407 (120 residues), 129.5 bits, E=5.7e-42

Best Hits

KEGG orthology group: None (inferred from 81% identity to pst:PSPTO_2940)

Predicted SEED Role

"3-ketoacyl-CoA thiolase (EC 2.3.1.16)" in subsystem Biotin biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle or n-Phenylalkanoic acid degradation (EC 2.3.1.16)

MetaCyc Pathways

• oleate β-oxidation (30/35 steps found)
• fatty acid salvage (6/6 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• ketolysis (3/3 steps found)
• L-isoleucine degradation I (5/6 steps found)
• valproate β-oxidation (7/9 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• propanoate fermentation to 2-methylbutanoate (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• acetoacetate degradation (to acetyl CoA) (1/2 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• ketogenesis (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• 5,6-dehydrokavain biosynthesis (engineered) (6/10 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
• 2-deoxy-D-ribose degradation II (4/8 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (1/4 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• acetyl-CoA fermentation to butanoate (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• ethylbenzene degradation (anaerobic) (1/5 steps found)
• isopropanol biosynthesis (engineered) (1/5 steps found)
• pyruvate fermentation to acetone (1/5 steps found)
• 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
• 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
• 4-ethylphenol degradation (anaerobic) (1/6 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (1/7 steps found)
• mevalonate pathway II (haloarchaea) (1/7 steps found)
• 3-phenylpropanoate degradation (3/10 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• methyl tert-butyl ether degradation (3/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• isoprene biosynthesis II (engineered) (1/8 steps found)
• mevalonate pathway III (Thermoplasma) (1/8 steps found)
• mevalonate pathway IV (archaea) (1/8 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
• 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
• ethylmalonyl-CoA pathway (1/11 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• L-tryptophan degradation III (eukaryotic) (3/15 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
• toluene degradation VI (anaerobic) (4/18 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (3/17 steps found)
• jasmonic acid biosynthesis (4/19 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• superpathway of L-lysine degradation (19/43 steps found)
• sitosterol degradation to androstenedione (1/18 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of ergosterol biosynthesis I (3/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (9/42 steps found)
• superpathway of cholesterol biosynthesis (3/38 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Ethylbenzene degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.16

Use Curated BLAST to search for 2.3.1.16

Sequence Analysis Tools

See A0A166QUH8 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Pf1N1B4_5589 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (Pseudomonas fluorescens FW300-N1B4)
VSGTGQYSSFGDVAIYEALRTPWVDLGGALAQVSPIDLGIKVGREVLARAAVDPSSVDSV
LAGSVAQASFDAYLLPRHIGLYSGVPQETPALGVQRICATGFELLRQAARQLDDGVQLAL
CVAAESMSRNPIAAYTHRSGFRLGAEVAFKDFLWEALYDPAPGVDMITTADNLARRHGLS
REEVDRYALGSHQLALQAQADGWFEPELVAVDNECFDLAGYQPRSILLPRGVDRVTRDSH
PRPTDLDALRRLRAVHAGGVQTAGNSCAVVDGAAAALVGRASAARRPVLAHLLASSVVGV
APEFMGIGPAPAIQLLLQRSGLALGDIGLLEINEAQAAQVLAVAQVLELDGDRLNRRGGS
IALGHPLAASGLRLVLTLARQLREGNLRYGIAAACVGGGQGMALLIENPAYQG