Protein Info for Pf1N1B4_5584 in Pseudomonas fluorescens FW300-N1B4

Annotation: Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12391: PCDO_beta_N
  • amino acids 12 to 43 (32 residues), 57.5 bits, 8.6e-20
• TIGR02422: protocatechuate 3,4-dioxygenase, beta subunit
  • amino acids 17 to 238 (222 residues), 360.3 bits, E=2e-112
• PF00775: Dioxygenase_C
  • amino acids 49 to 230 (182 residues), 211.5 bits, E=6.9e-67

Best Hits

Swiss-Prot: 89% identical to PCXB_PSEPU: Protocatechuate 3,4-dioxygenase beta chain (pcaH) from Pseudomonas putida

KEGG orthology group: K00449, protocatechuate 3,4-dioxygenase, beta subunit [EC: 1.13.11.3] (inferred from 96% identity to pfl:PFL_5396)

MetaCyc: 89% identical to protocatechuate 3,4-dioxygenase beta subunit (Pseudomonas putida)
Protocatechuate 3,4-dioxygenase. [EC: 1.13.11.3]; 1.13.11.- [EC: 1.13.11.3]

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• gallate degradation II (4/5 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• 4-sulfocatechol degradation (1/4 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

See A0A166QUE4 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Pf1N1B4_5584 Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3) (Pseudomonas fluorescens FW300-N1B4)
MSDADSSRFVIRDRNWHPKALTPDYKTSVARSPRQALVSIPQSASETSGPDFSHLKMGRF
DNDLLLNFNNGGLPVGERIIVSGRVCDQYGKPIPHTLVEMWQANAGGRYRHKNDRYLAPL
DPNFGGVGRALTDRDGYYSFRTIKPGPYPWRNGPNEWRPAHIHFSISGPSIASRLITQLY
FEGDPLIPMCPIVKSIANPEAVQSLIARLDMGNANPMDCLAYRFDIVLRGQRKTHFENC