Protein Info for Pf1N1B4_5550 in Pseudomonas fluorescens FW300-N1B4

Annotation: Group 2 RNA polymerase sigma factor @ Cyanobacteria-specific RpoD-like sigma factor, type-7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 284 to 506 (223 residues), 57.2 bits, see alignment E=8.2e-20 PF04542: Sigma70_r2" amino acids 289 to 355 (67 residues), 32 bits, see alignment E=1.3e-11 PF04545: Sigma70_r4" amino acids 456 to 506 (51 residues), 47 bits, see alignment 2.1e-16

Best Hits

KEGG orthology group: None (inferred from 36% identity to pfs:pQBR0465)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QSP2 at UniProt or InterPro

Protein Sequence (517 amino acids)

>Pf1N1B4_5550 Group 2 RNA polymerase sigma factor @ Cyanobacteria-specific RpoD-like sigma factor, type-7 (Pseudomonas fluorescens FW300-N1B4)
MNTAFAPITADLTSAQDDNVGRPDVGFQMPAAIPALPSRETPSSLLSGSEEADLGYRIQM
LSLKMLGAMAADVQVVERLAASILNSISSTDNSEQAAKLVYVNNRWVRIGDIPAKDFTAL
VREKVSAITLRLKELRAVSNANQAADLFNTIALENLRTAVCEVLPHDKLISQSAVEFKLR
CEDINKKCRALVRFVATELRITPRAVHRVACWNWVSPTLYAACINAGGYETAFIPAKARK
AFREGLISHQAAIIDAADRADVPLSHMLKSWDDFWLADRDLDIAQNTFVAANTRLVEMVV
RKYRFAKDMSQVYSAASMGLLRAVQLYAPEKGWKFSTYAVNWINQTVLRDLSKQDLIKLP
EGSHTALAILRKMLGEKPNTSIAELAEATQMEPDAVSDLLCYVEYFNSVSLDTAFTSDSG
ASEGIHDHIADANGDFVEDLIEADTSDYVMEVLSNVLDEREAKIVIGRYGIGGSEELTLT
EMATRLGLSIERVRQIAIRAVEKLRNSDFADALLELW