Protein Info for Pf1N1B4_5540 in Pseudomonas fluorescens FW300-N1B4

Annotation: Chromosome (plasmid) partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 33 to 207 (175 residues), 125.2 bits, see alignment E=1.3e-40 PF02195: ParBc" amino acids 35 to 122 (88 residues), 52.8 bits, see alignment E=3.7e-18 PF17762: HTH_ParB" amino acids 174 to 221 (48 residues), 36.6 bits, see alignment 3.4e-13

Best Hits

KEGG orthology group: None (inferred from 45% identity to pfs:pQBR0477)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QSF2 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Pf1N1B4_5540 Chromosome (plasmid) partitioning protein ParB (Pseudomonas fluorescens FW300-N1B4)
MALASTVETDESPAPLQWHVHGIKDVKLTMKRLGIDQLFPGLWQYRKSFPKKKMAELTVS
LKASRGNVVPCIVCPKADGSGYWIIAGERRWRAAQEAGVHELNCIIGDYTSAQAQFIAAA
ENLQREDPDPIEEAGAYQAMQETDLSHEQIAKLIGKSRGHVSNYIRLLSLGFGVRELIIN
GKLSASQARPICTLECTNEQLTVAKAAIKGKWSYRRIEEEVALRTQKKAPVVAMPKEDAD
VKRLARLVSETTGYPTVIIVKPTGSWQMGFAGG