Protein Info for Pf1N1B4_5514 in Pseudomonas fluorescens FW300-N1B4

Annotation: RecA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR02012: protein RecA" amino acids 7 to 326 (320 residues), 548.2 bits, see alignment E=3.3e-169 PF00154: RecA" amino acids 9 to 270 (262 residues), 473.2 bits, see alignment E=4.4e-146 PF08423: Rad51" amino acids 35 to 229 (195 residues), 34.4 bits, see alignment E=3e-12 PF21096: RecA_C" amino acids 274 to 327 (54 residues), 80.7 bits, see alignment 1.3e-26

Best Hits

Swiss-Prot: 85% identical to RECA_PSEE4: Protein RecA (recA) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K03553, recombination protein RecA (inferred from 85% identity to pen:PSEEN4128)

MetaCyc: 70% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XG05 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Pf1N1B4_5514 RecA protein (Pseudomonas fluorescens FW300-N1B4)
MMSNEGKQKALKQALEQIERQFGKGSVMRMGDNERVQIDAISTGSLGLDAALGIGGLPKG
RIVEIYGPESSGKTTLTLSVIAQAQKAGCTCAFVDAEHALDPEYAGKLGVIVDDLLVSQP
DTGEQALEITDMLVRSNAVDVIVVDSVAALVPKAEIEGEMGDMHVGLQARLMSQALRKIT
GNIKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKDGDEVTG
SATRVKVVKNKVSAPFRQAEFEIIYGAGINTMAEIIDLGSAAGLIEKSGSWYSYKGEKIG
QGKANSCIYLKEHPAVAAELDTAIREAKLPKLSATPDSNSDKVPEDDVA