Protein Info for Pf1N1B4_5467 in Pseudomonas fluorescens FW300-N1B4

Annotation: Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 132 to 148 (17 residues), see Phobius details amino acids 160 to 190 (31 residues), see Phobius details amino acids 212 to 238 (27 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details PF06750: A24_N_bact" amino acids 21 to 126 (106 residues), 104.1 bits, see alignment E=3.3e-34 PF01478: Peptidase_A24" amino acids 138 to 226 (89 residues), 67.9 bits, see alignment E=9.8e-23

Best Hits

Swiss-Prot: 42% identical to LEP4_VIBVU: Type 4 prepilin-like proteins leader peptide-processing enzyme (vvpD) from Vibrio vulnificus (strain CMCP6)

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 43% identity to vvy:VV2781)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162B2H7 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Pf1N1B4_5467 Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-) (Pseudomonas fluorescens FW300-N1B4)
MSGVLEQLAFYPSLYIPIFGIVGLMIGSFLNVVIYRLPKMLEAEWRAAAREYLAMDEETP
ERFNLAVPCSACPSCKRSIRPWENIPVLSYVALRGKCGGCSMRISVRYPLVELLGAGAGL
LAGWQFGLSLEALAMASVFWTLIALALIDHDTMMLPDSLCLPLLWAGLVFVAIVAPDQLA
AHVIGAATGYLAFRVLPIGEGDAKLAAACGAWLGWAALPFFVSVGAGISCLMWVLLYFRN
KASRQYPFGPALAVAFVLAVFYGKPYAHYLGLI