Protein Info for Pf1N1B4_532 in Pseudomonas fluorescens FW300-N1B4

Annotation: Transcriptional regulators, LysR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 218 to 235 (18 residues), see Phobius details PF00126: HTH_1" amino acids 4 to 62 (59 residues), 77 bits, see alignment E=8.9e-26 PF03466: LysR_substrate" amino acids 85 to 281 (197 residues), 146.7 bits, see alignment E=6.3e-47

Best Hits

Swiss-Prot: 49% identical to YNEJ_ECOLI: Uncharacterized HTH-type transcriptional regulator YneJ (yneJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a1422)

Predicted SEED Role

"Transcriptional regulators, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z455 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Pf1N1B4_532 Transcriptional regulators, LysR family (Pseudomonas fluorescens FW300-N1B4)
VEFSQLRIFQAVAQEGSITRAAERLHRVPSNLSTRLKQLEEQLGVELFVRERQRLQLSPA
GKVLLDYTAKLFALHDEAHAAVQGGQPAGDFVLGTMYSTAAIHLPELLARYHRSYPAVNL
QVQSGPSGELLEGLLTGRLDAALVDGPLELAGLDGVPLCDERLVLISEADHPPVRSALDV
EGRSVFTFRQGCSYRMRLEAWFAHDHAAMGRAMEIESYPGMLACVIAGSGVALMSESMLA
SLPGRESVAVHPLAEPFASATTWLMWRKGMVGANLNAWIEQQQAVYPSAAIQAQAIA