Protein Info for Pf1N1B4_5137 in Pseudomonas fluorescens FW300-N1B4

Annotation: Carboxynorspermidine decarboxylase, putative (EC 4.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR01047: carboxynorspermidine decarboxylase" amino acids 2 to 362 (361 residues), 411.7 bits, see alignment E=9.7e-128 PF00278: Orn_DAP_Arg_deC" amino acids 238 to 321 (84 residues), 28.2 bits, see alignment E=9.2e-11

Best Hits

Swiss-Prot: 66% identical to NSPC_HERAR: Carboxynorspermidine/carboxyspermidine decarboxylase (nspC) from Herminiimonas arsenicoxydans

KEGG orthology group: K13747, carboxynorspermidine decarboxylase [EC: 4.1.1.-] (inferred from 96% identity to pba:PSEBR_a2444)

MetaCyc: 50% identical to carboxynorspermidine decarboxylase (Vibrio cholerae)
RXN-9380 [EC: 4.1.1.96]

Predicted SEED Role

"Carboxynorspermidine decarboxylase, putative (EC 4.1.1.-)" in subsystem Polyamine Metabolism (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZEU3 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Pf1N1B4_5137 Carboxynorspermidine decarboxylase, putative (EC 4.1.1.-) (Pseudomonas fluorescens FW300-N1B4)
MIKTPYYLIDKQKLLANMQKIAYVREQSGAKALLALKCFATWSVFDLMQQYMDGTTSSSL
YELKLGRQKFAGETHAYSVAWADDEIEEMLDNCDKIIFNSIGQLQRYTEASAGKVRGLRV
NPQVSSSDYLLADPARPFSRLGEWDPVKIEQVIEQISGFMFHNNCENADFGLFDQMLCTI
EERFGHLLHKVEWVSLGGGIHFTGEGYAIDEFCARLKAFSQKYGVQVYLEPGEAAITQSA
SLEVTVLDTLYNGKHLAVVDSSIEAHMLDLLIYRLNAKLAPSEGEHTYMVCGKSCLAGDI
FGEYQFDRPLAIGDRLSFIDAAGYTMVKKNWFNGLKMPSIVVKQLDGTVEVVREFGYNDY
MSSLS