Protein Info for Pf1N1B4_5115 in Pseudomonas fluorescens FW300-N1B4

Updated annotation (from data): sucrose ABC transporter, ATPase component
Rationale: Specific phenotype on sucrose
Original annotation: Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 116 bits, see alignment E=5.2e-37 PF17912: OB_MalK" amino acids 235 to 287 (53 residues), 31.3 bits, see alignment 7.7e-11 PF08402: TOBE_2" amino acids 280 to 350 (71 residues), 53.8 bits, see alignment E=4.5e-18

Best Hits

KEGG orthology group: K10111, maltose/maltodextrin transport system ATP-binding protein [EC: 3.6.3.19] (inferred from 86% identity to pba:PSEBR_a2365)

Predicted SEED Role

"Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)" in subsystem Maltose and Maltodextrin Utilization (EC 3.6.3.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QFW2 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Pf1N1B4_5115 sucrose ABC transporter, ATPase component (Pseudomonas fluorescens FW300-N1B4)
VIKLKLDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDL
LIDGRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQI
LQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLH
DRLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMN
FLSARLQTPGETSLVDTLVWGITSLPFDSSNLAAGTPLSLGIRPEHVSLKAADGTAGVVV
TAVEYLGSETYVHLETGQDEPLICRCEVSAGWQAGDRVELLLDLDNLHLFDADGVALSRH
PHAIETLPAGVPLRSARASAL