Protein Info for Pf1N1B4_5111 in Pseudomonas fluorescens FW300-N1B4

Annotation: Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02264: LamB" amino acids 111 to 521 (411 residues), 314 bits, see alignment E=1.4e-97

Best Hits

KEGG orthology group: K02024, maltoporin (inferred from 92% identity to pba:PSEBR_a2368)

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QFR1 at UniProt or InterPro

Protein Sequence (521 amino acids)

>Pf1N1B4_5111 Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein) (Pseudomonas fluorescens FW300-N1B4)
MQKASSWLLAGVLGTSAATSQAATLEQRMAAFEARAAAAEKRAAAAEQQTQALARELQQI
KLATPALQPAASTTAATAAPTLDTRLAKLEARQQSMEKQDSSGHLTDGFSFKGYARSGLL
INDGLGGGRGGPYTTPAGSVGGAVGRLGNEDDTYMRIDLSKEMYAQNGTRSKFTVSIADG
VESSNDWTADESNLNVRQVFTELDHLAAFKGNSVFENSTLWAGKRFDRDNFDIHWLDSDV
VYLAGTGGGIYDVQMNKNWRSNYSLMGRNYGDFSEGGVNADVESYILTSNQFFDNGQWQW
MFNGIGSKKNDFGTRTNEAGLTPADSGLHSMLANHQKNFFGREGFFKTALLYGQGLGAEV
KNIGADGELIDDARALRLALYGETPIAPGWRIGPSLLAEQSKDRYVKGDDYRWMTLNVRL
ANEINSNFEMAYEMSWQTMDLDPKGYLQRNAVDGNFWKFTIAPTFKPDVGDLLTRPELRV
FASLMNWSSDLDGYSSTDNFGKSDFNAGGVWQYGIQMETWF