Protein Info for Pf1N1B4_5103 in Pseudomonas fluorescens FW300-N1B4

Annotation: Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 201 to 227 (27 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details PF12911: OppC_N" amino acids 21 to 61 (41 residues), 27.5 bits, see alignment 2.3e-10 PF00528: BPD_transp_1" amino acids 102 to 282 (181 residues), 100.9 bits, see alignment E=7.3e-33

Best Hits

Swiss-Prot: 39% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 90% identity to pba:PSEBR_a715)

MetaCyc: 39% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZE63 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Pf1N1B4_5103 Dipeptide transport system permease protein DppC (TC 3.A.1.5.2) (Pseudomonas fluorescens FW300-N1B4)
MSSQATTVPRLNLRLGLRNPRLAMGLGLTILFGWLVLAIFAPWIAPFDPIAQNTDIRLVA
PHLAHPFGTDNFGRDVLSRVIWSARIDLQLAVIGVIFPFLIGTCVGALSGYIGGRFDTFC
MRLIDIILAFPFLVLMLAIMAILGPGLMSFYIAMALVGWVSYARLIRSQILILKESDFAL
AAKSLGFGHGRILFRHLLPNAMFGSIVFSMSDAVLVLLNGAAVSYLGLGVQPPTAEWGTM
VAEGQSFITSAWWICTFPGLAIVTLAMGFSLLADAVAEHLGERS