Protein Info for Pf1N1B4_5097 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cyanate ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 48 to 71 (24 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 100 to 112 (13 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 36 to 234 (199 residues), 237 bits, see alignment E=7.7e-75 PF00528: BPD_transp_1" amino acids 70 to 239 (170 residues), 83.5 bits, see alignment E=8.4e-28

Best Hits

Swiss-Prot: 48% identical to NRTB_SYNY3: Nitrate import permease protein NrtB (nrtB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 86% identity to pmy:Pmen_2104)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162B129 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Pf1N1B4_5097 Cyanate ABC transporter, permease protein (Pseudomonas fluorescens FW300-N1B4)
LGIALFLAVWAFIAARSEGLPGPLATWYSALELFSAPFYDNGPNDMGIGWNVLASLGRVG
IGFGLAALLGIPLGFAIGRFAFLGGMFAPIISLLRPVSPLAWLPIGLLVFKAAGPASIWV
IFISSIWPIILNTAAGVASVPQDYLNVARVLKLSEWKVFTHILFPSVLPHLMTGIRLSIG
VAWLVIVAAEMLTGGVGLGFWVWDEWNNLNVEHILIAIIIVGLVGLLLEQGLLWIAKRFD
YTN