Protein Info for Pf1N1B4_5088 in Pseudomonas fluorescens FW300-N1B4

Annotation: Glycosyl transferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 83 to 106 (24 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 14 to 173 (160 residues), 33.2 bits, see alignment E=1e-11 PF00534: Glycos_transf_1" amino acids 191 to 344 (154 residues), 109 bits, see alignment E=3.9e-35 PF13692: Glyco_trans_1_4" amino acids 197 to 330 (134 residues), 102.6 bits, see alignment E=4.6e-33

Best Hits

KEGG orthology group: None (inferred from 80% identity to pfo:Pfl01_2820)

Predicted SEED Role

"Glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162B118 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Pf1N1B4_5088 Glycosyl transferase, group 1 family protein (Pseudomonas fluorescens FW300-N1B4)
MKRLLIILQDLSGGGAEKMMARLACALTDAGNDVTLLMLTGTGVNSVRLDPRVKQVQLHS
ARSSRAVPALARFLRHNRFDAQLAALTHVNVVAIAAAALSGTLARLHVSERNAFSHDKHV
NPALMVRIAYLLAPLLYRLIPNPVICVSRGVAQDLVDTTITRPQDVTIADNPVLDNDFRD
KAPGRPNHRWLSKKTTPVIVAVGRLARQKGFDVLLDAFARLADPSVRLIIFGEGALRAEL
REQAVALGVADRFDLPGYTNDPLAEVAAADCFVLSSRFEGSPNALVEALSTGTPVVSTHC
PYGPQEILDNGAIAPLVAVDDPDALARAITVELTLPRDANRQARIDAAARFVSACAAKTY
LDAMLGGVLN