Protein Info for Pf1N1B4_5039 in Pseudomonas fluorescens FW300-N1B4
Annotation: Multiple polyol-specific dehydrogenase (EC 1.1.1.-)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 76% identical to SDH_RHOSH: Sorbitol dehydrogenase (polS) from Rhodobacter sphaeroides
KEGG orthology group: K08261, D-sorbitol dehydrogenase (acceptor) [EC: 1.1.99.21] (inferred from 89% identity to pst:PSPTO_0363)MetaCyc: 62% identical to galactitol 2-dehydrogenase (Agrobacterium fabrum C58)
Galactitol 2-dehydrogenase. [EC: 1.1.1.16]
Predicted SEED Role
"Multiple polyol-specific dehydrogenase (EC 1.1.1.-)" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.-)
MetaCyc Pathways
- mannitol cycle (4/5 steps found)
- 2-keto-L-gulonate biosynthesis (2/4 steps found)
- L-ascorbate biosynthesis III (D-sorbitol pathway) (2/4 steps found)
- D-altritol and galactitol degradation (1/4 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of type II polyketide products
- Biosynthesis of unsaturated fatty acids
- Bisphenol A degradation
- Butanoate metabolism
- C21-Steroid hormone metabolism
- Fructose and mannose metabolism
- Galactose metabolism
- Glycine, serine and threonine metabolism
- Insect hormone biosynthesis
- Linoleic acid metabolism
- Nucleotide sugars metabolism
- Polyketide sugar unit biosynthesis
- Retinol metabolism
- Tetrachloroethene degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.-
Use Curated BLAST to search for 1.1.1.- or 1.1.1.16 or 1.1.99.21
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A166QE91 at UniProt or InterPro
Protein Sequence (257 amino acids)
>Pf1N1B4_5039 Multiple polyol-specific dehydrogenase (EC 1.1.1.-) (Pseudomonas fluorescens FW300-N1B4) MKRLEGKSALITGSARGIGRTFAQAYIREGATVAIADINLERAQATAAELWPNAYAVEMD VTDQQSIDGAIAAVIATTGKLDILINNAALFDLAPITEISRDSYERLFSINVSGTLFTLQ AAAKQMIRQGHGGKIINMASQAGRRGEALVAVYCATKAAVISLTQSAGLNLIPHNINVNA IAPGVVDGEHWDGVDALFAKYENRPLGEKKKLAGQEVPYGRMGTADDLVGMAIFLASAES DYIVAQTYNVDGGNWMS