Protein Info for Pf1N1B4_5029 in Pseudomonas fluorescens FW300-N1B4

Annotation: Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13531: SBP_bac_11" amino acids 27 to 251 (225 residues), 206.1 bits, see alignment E=6.7e-65 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 32 to 249 (218 residues), 268.5 bits, see alignment E=2.7e-84 PF01547: SBP_bac_1" amino acids 32 to 242 (211 residues), 62.4 bits, see alignment E=7.7e-21

Best Hits

Swiss-Prot: 74% identical to MODA_AZOVI: Molybdate-binding protein ModA (modA) from Azotobacter vinelandii

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 91% identity to pfl:PFL_3412)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QE26 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Pf1N1B4_5029 Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1) (Pseudomonas fluorescens FW300-N1B4)
MTIRASRFAPACLLTVFAFGSALADEVQVAVAANFTAPIQAIAADFEKDTGHKLVTSFGA
TGQFYTQIKNGAPFEVFLSADDITPKKLETEGDTVKGSRFTYAIGTLALWSAKEGYVDAK
GKVLSDNQYQHLSIANPKAAPYGLAATQVLAKQGLTDKVKDKIVEGQNITQAYQFVSTGN
AELGFVALSQIYKDGKVTSGSAWIVPADLHDPIKQDAVILNKGKDNPAAKALVDYLKGPK
AAAVIKSYGYQL