Protein Info for Pf1N1B4_5015 in Pseudomonas fluorescens FW300-N1B4

Annotation: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR01099: UTP--glucose-1-phosphate uridylyltransferase" amino acids 2 to 264 (263 residues), 402.5 bits, see alignment E=4.4e-125 PF00483: NTP_transferase" amino acids 9 to 267 (259 residues), 115.9 bits, see alignment E=1.2e-37

Best Hits

Swiss-Prot: 89% identical to GALU_PSEAE: UTP--glucose-1-phosphate uridylyltransferase (galU) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 99% identity to pfo:Pfl01_2929)

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.9

Use Curated BLAST to search for 2.7.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QDT2 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Pf1N1B4_5015 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (Pseudomonas fluorescens FW300-N1B4)
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLTEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGDGVLTQMVKLYKQFRCSIVAIQEVDPQETHKYGVIAGEMIRD
DIYRVHSMVEKPKPEDAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQN
GCVMAYKFKGKRFDCGGAEGYIDATNFCFENFYKTGKAY