Protein Info for Pf1N1B4_4984 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG01200701: possible membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF11737: DUF3300" amino acids 50 to 291 (242 residues), 300.3 bits, see alignment E=4.3e-94

Best Hits

KEGG orthology group: None (inferred from 73% identity to ppg:PputGB1_2410)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QD44 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Pf1N1B4_4984 FIG01200701: possible membrane protein (Pseudomonas fluorescens FW300-N1B4)
MRIPLFYAVSVVLFLSGSSCLAQPLDASATTSASSTAPVTSVAKDAVFTQEQLDQMLAPI
ALYPDPLLAQVLMATTYPGEIAEAVTWSKAHPDAKGDDAVKQVANQPWDPSVQALVAFPQ
VMATLGQDPVWVQRLGDAFLAQPDDVMGGVQRLRHQAQAAGNLQSNQYQNVTVQAAPASA
APAPAPATSTSTIIIQPSDPQVVYVPTYNPTTTYGTWPYPASPPVYYPPPPAYYPGSALL
AGLAFGTGVAIIGSLWGDCDWDNNDIDIDVDRYNNINRNNQITRNQNNWQHNAVHRDGVP
YRDSKSREQYGRQLDGARQREAYRGDNAQRAQAREKARGSMDKHGIERPATSNREARDSA
RKAQSATSPGNRMQAGTDRPKASDRSQGTARSTRENQQPRKQTAQVNQRGQGDLQGRQTA
QKRPAASTGSAGSARNNAFAGVRSPSQANAQASRGQASQASARRPSASRPAGHQVSRPSS
PPARQRGGRR